PDB entry 1y8f

View 1y8f on RCSB PDB site
Description: Solution structure of the munc13-1 C1-domain
Class: endocytosis/exocytosis,signaling protein
Keywords: cysteine-rich domain, c1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex
Deposited on 2004-12-12, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: unc-13 homolog a
  Species: Rattus norvegicus [TaxId:10116]
  Gene: MUNC13-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q62768 (13-62)
    • cloning artifact (12)
  Domains in SCOPe 2.07: d1y8fa1, d1y8fa2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1y8fA (A:)
  gspgisgggggiqhnfevwtattptycyecegllwgiarqgmrctecgvkchekcqdlln
  adckln
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1y8fA (A:)
  qhnfevwtattptycyecegllwgiarqgmrctecgvkchekcqdllnadc