PDB entry 1y8f

View 1y8f on RCSB PDB site
Description: Solution structure of the munc13-1 C1-domain
Class: endocytosis/exocytosis,signaling protein
Keywords: cysteine-rich domain, c1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex
Deposited on 2004-12-12, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unc-13 homolog a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MUNC13-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62768 (13-62)
      • cloning artifact (12)
    Domains in SCOPe 2.08: d1y8fa1, d1y8fa2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y8fA (A:)
    gspgisgggggiqhnfevwtattptycyecegllwgiarqgmrctecgvkchekcqdlln
    adckln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8fA (A:)
    qhnfevwtattptycyecegllwgiarqgmrctecgvkchekcqdllnadc