PDB entry 1y8c

View 1y8c on RCSB PDB site
Description: Crystal structure of a S-adenosylmethionine-dependent methyltransferase from Clostridium acetobutylicum ATCC 824
Class: transferase
Keywords: Structural Genomics; Protein Structure Initiative; PSI; NYSGXRC; New York SGX Research Center for Structural Genomics; T1987; CAC2371; methyltransferase, transferase
Deposited on 2004-12-11, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-adenosylmethionine-dependent methyltransferase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: CAC2371, 1118554
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97GJ5 (0-245)
      • modified residue (70)
      • modified residue (178)
    Domains in SCOPe 2.08: d1y8ca_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8cA (A:)
    ncynkfahiydkliradvdykkwsdfiiekcvennlvfddyldlacgtgnltenlcpkfk
    ntwavdlsqemlseaenkfrsqglkprlacqdisnlninrkfdlitccldstnyiidsdd
    lkkyfkavsnhlkeggvfifdinsyyklsqvlgnndfnydddevfyywenqfeddlvsmy
    isffvrdgefykrfdeeheeraykeediekylkhgqlnildkvdcysnkkvekfterity
    lvklgg