PDB entry 1y8b

View 1y8b on RCSB PDB site
Description: Solution NMR-Derived Global Fold of Malate Synthase G from E.coli
Class: transferase
Keywords: NMR Global Fold, Apo-Malate Synthase G, 82 kDa Enzyme, TRANSFERASE
Deposited on 2004-12-10, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate synthase g
    Species: Escherichia coli [TaxId:562]
    Gene: glcB, glc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37330 (1-722)
      • initiating methionine (0)
      • engineered (1)
    Domains in SCOPe 2.07: d1y8ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y8bA (A:)
    maqtitqsrlridanfkrfvdeevlpgtgldaaafwrnfdeivhdlapenrqllaerdri
    qaaldewhrsnpgpvkdkaayksflrelgylvpqpervtvettgidseitsqagpqlvvp
    amnaryalnaanarwgslydalygsdiipqegamvsgydpqrgeqviawvrrfldeslpl
    engsyqdvvafkvvdkqlriqlkngkettlrtpaqfvgyrgdaaaptcillknnglhiel
    qidangrigkddpahindviveaaistildcedsvaavdaedkillyrnllglmqgtlqe
    kmekngrqivrklnddrhytaadgseislhgrsllfirnvghlmtipviwdsegneipeg
    ildgvmtgaialydlkvqknsrtgsvyivkpkmhgpqevafanklftrietmlgmapntl
    kmgimdeerrtslnlrsciaqarnrvafintgfldrtgdemhsvmeagpmlrknqmkstp
    wikayernnvlsglfcglrgkaqigkgmwampdlmadmysqkgdqlragantawvpspta
    atlhalhyhqtnvqsvqaniaqtefnaefepllddlltipvaenanwsaqeiqqeldnnv
    qgilgyvvrwveqgigcskvpdihnvalmedratlrissqhianwlrhgiltkeqvqasl
    enmakvvdqqnagdpayrpmagnfanscafkaasdliflgvkqpngytepllhawrlrek
    eshlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8bA (A:)
    maqtitqsrlridanfkrfvdeevlpgtgldaaafwrnfdeivhdlapenrqllaerdri
    qaaldewhrsnpgpvkdkaayksflrelgylvpqpervtvettgidseitsqagpqlvvp
    amnaryalnaanarwgslydalygsdiipqegamvsgydpqrgeqviawvrrfldeslpl
    engsyqdvvafkvvdkqlriqlkngkettlrtpaqfvgyrgdaaaptcillknnglhiel
    qidangrigkddpahindviveaaistildcedsvaavdaedkillyrnllglmqgtlqe
    kmekngrqivrklnddrhytaadgseislhgrsllfirnvghlmtipviwdsegneipeg
    ildgvmtgaialydlkvqknsrtgsvyivkpkmhgpqevafanklftrietmlgmapntl
    kmgimdeerrtslnlrsciaqarnrvafintgfldrtgdemhsvmeagpmlrknqmkstp
    wikayernnvlsglfcglrgkaqigkgmwampdlmadmysqkgdqlragantawvpspta
    atlhalhyhqtnvqsvqaniaqtefnaefepllddlltipvaenanwsaqeiqqeldnnv
    qgilgyvvrwveqgigcskvpdihnvalmedratlrissqhianwlrhgiltkeqvqasl
    enmakvvdqqnagdpayrpmagnfanscafkaasdliflgvkqpngytepllhawrlrek
    esh