PDB entry 1y89

View 1y89 on RCSB PDB site
Description: Crystal Structure of devB protein
Deposited on 2004-12-10, released 2005-01-25
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: devB protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB AAF96794 (0-237)
      • modified residue (0)
      • modified residue (20)
      • modified residue (42)
      • modified residue (93)
      • modified residue (118)
  • Chain 'B':
    Compound: devB protein
    Species: Vibrio cholerae [TaxId:243277]
    Database cross-references and differences (RAF-indexed):
    • GB AAF96794 (0-237)
      • modified residue (0)
      • modified residue (20)
      • modified residue (42)
      • modified residue (93)
      • modified residue (118)
  • Heterogens: PO4, 2PE, PE5, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1y89A (A:)
    minhkifptadavvksladdmlaysqqgqpvhislsggstpkmlfkllasqpyandiqwk
    nlhfwwgdercvapddaesnygeanallfskinmpaqnihrilgenepqaeaerfaqama
    hviptengtpvfdwillgvgadghtaslfpgqtdyadanlsvvashpesgqlrvsktakv
    lqaakrisylvlgagkaeiveqihttpaeqlpypaakihstsgvtewyldsdaaakia
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1y89B (B:)
    minhkifptadavvksladdmlaysqqgqpvhislsggstpkmlfkllasqpyandiqwk
    nlhfwwgdercvapddaesnygeanallfskinmpaqnihrilgenepqaeaerfaqama
    hviptengtpvfdwillgvgadghtaslfpgqtdyadanlsvvashpesgqlrvsktakv
    lqaakrisylvlgagkaeiveqihttpaeqlpypaakihstsgvtewyldsdaaakia