PDB entry 1y88

View 1y88 on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function AF1548
Class: structural genomics, unknown function
Keywords: AF1548, APC5567, Structural genomics, Protein Structure Initiative, PSI, Midwest Center for Structural Genomics Center, MCSG, UNKNOWN FUNCTION
Deposited on 2004-12-10, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.203
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AF1548
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28724 (22-196)
      • cloning artifact (15-21)
      • cloning artifact (23)
      • cloning artifact (197-198)
    Domains in SCOPe 2.07: d1y88a1, d1y88a2, d1y88a3, d1y88a4
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y88A (A:)
    mgsshhhhhhssgrenlyfqghmvarlleehgfetktnvivqgncveqeidvvaerdger
    ymieckfhnipvytglkeamytyarfldvekhgftqpwiftntkfseeakkyagcvgikl
    tgwsypekegievlleskglypitilridkevldelvraglvfcrdvvsageeklreigl
    sakkareviaeakkviggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y88A (A:)
    nlyfqghmvarlleehgfetktnvivqgncveqeidvvaerdgerymieckfhnipvytg
    lkeamytyarfldvekhgftqpwiftntkfseeakkyagcvgikltgwsypekegievll
    eskglypitilridkevldelvraglvfcrdvvsageeklreiglsakkareviaeakkv
    iggs