PDB entry 1y82

View 1y82 on RCSB PDB site
Description: Conserved hypothetical protein Pfu-367848-001 from Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: Structural Genomics, conserved hypothetical protein, SECSG, PSI, Southeast Collaboratory for Structural Genomics, Protein Structure Initiative, Pyrococcus furiosus, Pfu-367848-001, hyperthermophile, UNKNOWN FUNCTION
Deposited on 2004-12-10, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3V0 (9-End)
      • modified residue (24)
      • modified residue (29)
      • modified residue (95)
      • modified residue (99-100)
      • modified residue (130)
      • modified residue (138)
      • modified residue (150)
    Domains in SCOPe 2.07: d1y82a1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3V0
      • modified residue (24)
      • modified residue (29)
      • modified residue (95)
      • modified residue (99-100)
      • modified residue (130)
      • modified residue (138)
      • modified residue (150)
    Domains in SCOPe 2.07: d1y82b_
  • Chain 'C':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3V0
      • modified residue (24)
      • modified residue (29)
      • modified residue (95)
      • modified residue (99-100)
      • modified residue (130)
      • modified residue (138)
      • modified residue (150)
    Domains in SCOPe 2.07: d1y82c_
  • Chain 'D':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3V0
      • modified residue (24)
      • modified residue (29)
      • modified residue (95)
      • modified residue (99-100)
      • modified residue (130)
      • modified residue (138)
    Domains in SCOPe 2.07: d1y82d_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y82A (A:)
    ahhhhhhgsplppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvrayl
    kknieleldvlkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksll
    itddskryepmrrfgldtmpldkfvkevelmvekeli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y82A (A:)
    plppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleld
    vlkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskrye
    pmrrfgldtmpldkfvkevelmvekel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y82B (B:)
    ahhhhhhgsplppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvrayl
    kknieleldvlkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksll
    itddskryepmrrfgldtmpldkfvkevelmvekeli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y82B (B:)
    lppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleldv
    lkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskryep
    mrrfgldtmpldkfvkevelmvekel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y82C (C:)
    ahhhhhhgsplppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvrayl
    kknieleldvlkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksll
    itddskryepmrrfgldtmpldkfvkevelmvekeli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y82C (C:)
    lppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleldv
    lkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskryep
    mrrfgldtmpldkfvkevelmvekel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y82D (D:)
    ahhhhhhgsplppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvrayl
    kknieleldvlkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksll
    itddskryepmrrfgldtmpldkfvkevelmvekeli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y82D (D:)
    lppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleldv
    lkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskryep
    mrrfgldtmpldkfvkeve