PDB entry 1y81

View 1y81 on RCSB PDB site
Description: Conserved hypothetical protein Pfu-723267-001 from Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, unknown function
Deposited on 2004-12-10, released 2005-01-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.223
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein
  Species: Pyrococcus furiosus [TaxId:2261]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U2V3
    • modified residue (125)
  Domains in SCOPe 2.03: d1y81a1
• Heterogens: SCN, COA, UNX, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1y81A (A:)
  ahhhhhhgsnskefrkialvgasknpakygniilkdllskgfevlpvnpnydeieglkcy
  rsvrelpkdvdvivfvvppkvglqvakeaveagfkklwfqpgaeseeirrflekagveys
  fgrcimvetsnkkiflev
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1y81A (A:)
  frkialvgasknpakygniilkdllskgfevlpvnpnydeieglkcyrsvrelpkdvdvi
  vfvvppkvglqvakeaveagfkklwfqpgaeseeirrflekagveysfgrcimvet