PDB entry 1y81

View 1y81 on RCSB PDB site
Description: Conserved hypothetical protein Pfu-723267-001 from Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2004-12-10, released 2005-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.223
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Pyrococcus furiosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U2V3
      • modified residue (125)
    Domains in SCOP 1.73: d1y81a1
  • Heterogens: SCN, COA, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y81A (A:)
    ahhhhhhgsnskefrkialvgasknpakygniilkdllskgfevlpvnpnydeieglkcy
    rsvrelpkdvdvivfvvppkvglqvakeaveagfkklwfqpgaeseeirrflekagveys
    fgrcimvetsnkkiflev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y81A (A:)
    frkialvgasknpakygniilkdllskgfevlpvnpnydeieglkcyrsvrelpkdvdvi
    vfvvppkvglqvakeaveagfkklwfqpgaeseeirrflekagveysfgrcimvet