PDB entry 1y80

View 1y80 on RCSB PDB site
Description: structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
Deposited on 2004-12-10, released 2005-01-25
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted cobalamin binding protein
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00329980
  • Heterogens: B1M, UNX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y80A (A:)
    mptyeelsqavfegdeaqvveltrsllsggaeplevinkgliagmdrvgvlfknnemfvp
    evlmsanamnagvevvkqsqqafdmpsvgkivlgtvkgdlhdigknlvammlesggftvy
    nlgvdiepgkfveavkkyqpdivgmsalltttmmnmkstidaliaaglrdrvkvivggap
    lsqdfadeigadgyapdaasatelcrqlle
    

    Sequence, based on observed residues (ATOM records):
    >1y80A (A:)
    mpsvgkivlgtvkgdlhdigknlvammlesggftvynlgvdiepgkfveavkkyqpdivg
    msalltttmmnmkstidaliaaglrdrvkvivggaplsqdfadeigadgyapdaasatel
    crqll