PDB entry 1y7y

View 1y7y on RCSB PDB site
Description: High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila
Class: Transcription regulator
Keywords: helix-turn-helix, DNA-binding protein, transcriptional regulator
Deposited on 2004-12-10, released 2005-02-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.169
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C.AhdI
    Species: Aeromonas hydrophila
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y7ya1
  • Chain 'B':
    Compound: C.AhdI
    Species: Aeromonas hydrophila
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y7yb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7yA (A:)
    mqshhdhyadlvkfgqrlrelrtakglsqetlaflsgldrsyvggvergqrnvslvnilk
    lataldieprelfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7yA (A:)
    hdhyadlvkfgqrlrelrtakglsqetlaflsgldrsyvggvergqrnvslvnilklata
    ldieprelf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y7yB (B:)
    mqshhdhyadlvkfgqrlrelrtakglsqetlaflsgldrsyvggvergqrnvslvnilk
    lataldieprelfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7yB (B:)
    yadlvkfgqrlrelrtakglsqetlaflsgldrsyvggvergqrnvslvnilklataldi
    eprelf