PDB entry 1y7w

View 1y7w on RCSB PDB site
Description: Crystal structure of a halotolerant carbonic anhydrase from Dunaliella salina
Class: lyase
Keywords: alpha-type carbonic anhydrase, haltolerant protein, algal carbonic anhydrase, salt tolerant protein, zinc enzyme, anion tolerance, Dunaliella salina carbonic anhydrase, dCA II, Israel Structural Proteomics Center, ISPC, Structural Genomics, LYASE
Deposited on 2004-12-10, released 2005-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.167
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Halotolerant alpha-type carbonic anhydrase (dCA II)
    Species: Dunaliella salina [TaxId:3046]
    Gene: dCA II
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y7W (Start-290)
    Domains in SCOPe 2.06: d1y7wa_
  • Chain 'B':
    Compound: Halotolerant alpha-type carbonic anhydrase (dCA II)
    Species: Dunaliella salina [TaxId:3046]
    Gene: dCA II
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y7W (Start-290)
    Domains in SCOPe 2.06: d1y7wb_
  • Heterogens: NA, ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7wA (A:)
    masmtggqqmgrgseepnpndgydymqhgfdwpglqeggttkypacsgsnqspidintnq
    lmepssrsgtsavslnglnvdgaqadgitltnakvdleqgmkvtfdqpaanlptieiggt
    tksfvpiqfhfhhflsehtingihyplelhivmqeqdpadvataqlavigimykysengd
    aflnslqtqiegkigdgtasygdtgvsidninvktqllpsslkyagydgslttpgcderv
    kwhvfttprevtreqmklfvdvtmgahagadvvnnrmiqdlgdrevykyny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7wA (A:)
    npndgydymqhgfdwpglqeggttkypacsgsnqspidintnqlmepssrsgtsavslng
    lnvdgaqadgitltnakvdleqgmkvtfdqpaanlptieiggttksfvpiqfhfhhflse
    htingihyplelhivmqeqdpadvataqlavigimykysengdaflnslqtqiegkigdg
    tasygdtgvsidninvktqllpsslkyagydgslttpgcdervkwhvfttprevtreqmk
    lfvdvtmgahagadvvnnrmiqdlgdrevykyny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y7wB (B:)
    masmtggqqmgrgseepnpndgydymqhgfdwpglqeggttkypacsgsnqspidintnq
    lmepssrsgtsavslnglnvdgaqadgitltnakvdleqgmkvtfdqpaanlptieiggt
    tksfvpiqfhfhhflsehtingihyplelhivmqeqdpadvataqlavigimykysengd
    aflnslqtqiegkigdgtasygdtgvsidninvktqllpsslkyagydgslttpgcderv
    kwhvfttprevtreqmklfvdvtmgahagadvvnnrmiqdlgdrevykyny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7wB (B:)
    npndgydymqhgfdwpglqeggttkypacsgsnqspidintnqlmepssrsgtsavslng
    lnvdgaqadgitltnakvdleqgmkvtfdqpaanlptieiggttksfvpiqfhfhhflse
    htingihyplelhivmqeqdpadvataqlavigimykysengdaflnslqtqiegkigdg
    tasygdtgvsidninvktqllpsslkyagydgslttpgcdervkwhvfttprevtreqmk
    lfvdvtmgahagadvvnnrmiqdlgdrevykyny