PDB entry 1y7u

View 1y7u on RCSB PDB site
Description: Crystal Structure of Acyl-Coa hydrolase from Bacillus cereus
Class: hydrolase
Keywords: Acyl-CoA hydrolase, Structural Genomics, Coenzyme A, Protein structure initiative, PSI, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2004-12-10, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA hydrolase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EE4 (Start-173)
      • modified residue (45)
      • modified residue (47)
      • modified residue (66)
      • modified residue (95)
    Domains in SCOPe 2.07: d1y7ua1
  • Chain 'B':
    Compound: acyl-CoA hydrolase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EE4 (Start-173)
      • modified residue (45)
      • modified residue (47)
      • modified residue (66)
      • modified residue (95)
    Domains in SCOPe 2.07: d1y7ub_
  • Chain 'C':
    Compound: acyl-CoA hydrolase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EE4 (Start-173)
      • modified residue (45)
      • modified residue (47)
      • modified residue (66)
      • modified residue (95)
    Domains in SCOPe 2.07: d1y7uc_
  • Heterogens: CA, SO4, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7uA (A:)
    snamitmtevkgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrk
    ecvtasmdwvdflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfv
    tfvalskennpvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7uA (A:)
    kgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrkecvtasmdwv
    dflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfvtfvalskenn
    pvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y7uB (B:)
    snamitmtevkgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrk
    ecvtasmdwvdflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfv
    tfvalskennpvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7uB (B:)
    kgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrkecvtasmdwv
    dflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfvtfvalskenn
    pvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y7uC (C:)
    snamitmtevkgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrk
    ecvtasmdwvdflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfv
    tfvalskennpvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7uC (C:)
    kgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrkecvtasmdwv
    dflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfvtfvalskenn
    pvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf