PDB entry 1y7t

View 1y7t on RCSB PDB site
Description: Crystal structure of NAD(H)-depenent malate dehydrogenase complexed with NADPH
Class: oxidoreductase
Keywords: nad-dependent-mdh-nadph complex, oxidoreductase
Deposited on 2004-12-10, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.197
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y7ta1, d1y7ta2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y7tb1, d1y7tb2
  • Heterogens: NDP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7tA (A:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhsstmfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7tB (B:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhsstmfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli