PDB entry 1y7r

View 1y7r on RCSB PDB site
Description: 1.7 A Crystal Structure of Protein of Unknown Function SA2161 from Meticillin-Resistant Staphylococcus aureus, Probable Acetyltransferase
Class: structural genomics, unknown function
Keywords: Structural Genomics, hypothetical protein, Protein structure initiative, PSI, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-12-09, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein SA2161
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99RQ6 (0-132)
    • engineered (71)
    • engineered (78)
    • engineered (99)
    • engineered (114)
  Domains in SCOPe 2.07: d1y7ra1
• Chain 'B':
  Compound: hypothetical protein SA2161
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99RQ6 (0-132)
    • engineered (71)
    • engineered (78)
    • engineered (99)
    • engineered (114)
  Domains in SCOPe 2.07: d1y7rb_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y7rA (A:)
  mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
  gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
  ptepdsggmyiky
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y7rB (B:)
  mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
  gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
  ptepdsggmyiky