PDB entry 1y7r

View 1y7r on RCSB PDB site
Description: 1.7 A Crystal Structure of Protein of Unknown Function SA2161 from Meticillin-Resistant Staphylococcus aureus, Probable Acetyltransferase
Class: structural genomics, unknown function
Keywords: Structural Genomics, hypothetical protein, Protein structure initiative, PSI, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-12-09, released 2005-01-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein SA2161
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99RQ6 (0-132)
      • engineered (71)
      • engineered (78)
      • engineered (99)
      • engineered (114)
    Domains in SCOPe 2.01: d1y7ra1
  • Chain 'B':
    Compound: hypothetical protein SA2161
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99RQ6 (0-132)
      • engineered (71)
      • engineered (78)
      • engineered (99)
      • engineered (114)
    Domains in SCOPe 2.01: d1y7rb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7rA (A:)
    mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
    gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
    ptepdsggmyiky
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7rB (B:)
    mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
    gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
    ptepdsggmyiky