PDB entry 1y7r
View 1y7r on RCSB PDB site
Description: 1.7 A Crystal Structure of Protein of Unknown Function SA2161 from Meticillin-Resistant Staphylococcus aureus, Probable Acetyltransferase
Class: structural genomics, unknown function
Keywords: Structural Genomics, hypothetical protein, Protein structure initiative, PSI, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on
2004-12-09, released
2005-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hypothetical protein SA2161
Species: Staphylococcus aureus [TaxId:1280]
Database cross-references and differences (RAF-indexed):
- Uniprot Q99RQ6 (0-132)
- engineered (71)
- engineered (78)
- engineered (99)
- engineered (114)
Domains in SCOPe 2.08: d1y7ra1 - Chain 'B':
Compound: hypothetical protein SA2161
Species: Staphylococcus aureus [TaxId:1280]
Database cross-references and differences (RAF-indexed):
- Uniprot Q99RQ6 (0-132)
- engineered (71)
- engineered (78)
- engineered (99)
- engineered (114)
Domains in SCOPe 2.08: d1y7rb_ - Heterogens: PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1y7rA (A:)
mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
ptepdsggmyiky
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1y7rB (B:)
mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
ptepdsggmyiky