PDB entry 1y7q

View 1y7q on RCSB PDB site
Description: Mammalian SCAN domain dimer is a domain-swapped homologue of the HIV capsid C-terminal domain
Class: transcription
Keywords: SCAN domain; retroviral capsid C-terminal domain; dimer; C2H2 zinc finger associated, TRANSCRIPTION
Deposited on 2004-12-09, released 2005-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger protein 174
  Species: Homo sapiens [TaxId:9606]
  Gene: ZNF174, ZSCAN8
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15697 (2-97)
    • cloning artifact (0-1)
    • engineered (65)
    • engineered (76)
  Domains in SCOPe 2.08: d1y7qa1, d1y7qa2
• Chain 'B':
  Compound: Zinc finger protein 174
  Species: Homo sapiens [TaxId:9606]
  Gene: ZNF174, ZSCAN8
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15697 (2-97)
    • cloning artifact (0-1)
    • engineered (65)
    • engineered (76)
  Domains in SCOPe 2.08: d1y7qb2, d1y7qb3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y7qA (A:)
  gskncpdpelcrqsfrrfcyqevsgpqealsqlrqlcrqwlqpelhtkeqilellvmeqf
  ltilpeeiqarvrhrclmsskeivtlvedfhraskkpk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y7qB (B:)
  gskncpdpelcrqsfrrfcyqevsgpqealsqlrqlcrqwlqpelhtkeqilellvmeqf
  ltilpeeiqarvrhrclmsskeivtlvedfhraskkpk