PDB entry 1y7p

View 1y7p on RCSB PDB site
Description: 1.9 A Crystal Structure of a Protein of Unknown Function AF1403 from Archaeoglobus fulgidus, Probable Metabolic Regulator
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein structure initiative, PSI, Archaeoglobus fulgidus, alpha-beta-alpha sandwich, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-12-09, released 2005-02-01
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.211
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AF1403
    Species: Archaeoglobus fulgidus
    Gene: AF1403
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y7pa1, d1y7pa2
  • Chain 'B':
    Compound: Hypothetical protein AF1403
    Species: Archaeoglobus fulgidus
    Gene: AF1403
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28869 (2-End)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1y7pb1, d1y7pb2
  • Chain 'C':
    Compound: Hypothetical protein AF1403
    Species: Archaeoglobus fulgidus
    Gene: AF1403
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28869 (Start-220)
      • cloning artifact (221-222)
    Domains in SCOP 1.73: d1y7pc1, d1y7pc2
  • Heterogens: RIP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7pA (A:)
    ghmlrglriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdf
    ekilervktfdyiieieeeesfervfgkrviilgggalvsqvaigaiseadrhnlrgeri
    svdtmpvvgeeeiaeavkavsrlhraevlvlaggimggkiteevkklrksgirvislsmf
    gsvpdvadvvisdpvmagtlavmhisekakfdldrvkgrrigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7pA (A:)
    lrglriiaenkigvlrdlttiianitfaqtflikhgehegkaliyfeieggdfekilerv
    ktfdyiieieeeesfervfgkrviilgggalvsqvaigaiseadrhnlrgerisvdtmpv
    vgeeeiaeavkavsrlhraevlvlaggimggkiteevkklrksgirvislsmfgsvpdva
    dvvisdpvmagtlavmhisekakfdldrvkgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y7pB (B:)
    ghmlrglriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdf
    ekilervktfdyiieieeeesfervfgkrviilgggalvsqvaigaiseadrhnlrgeri
    svdtmpvvgeeeiaeavkavsrlhraevlvlaggimggkiteevkklrksgirvislsmf
    gsvpdvadvvisdpvmagtlavmhisekakfdldrvkgrrigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7pB (B:)
    ghmlrglriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdf
    ekilervktfdyiieieeeesfervfgkrviilgggalvsqvaigaiseadrhnlrgeri
    svdtmpvvgeeeiaeavkavsrlhraevlvlaggimggkiteevkklrksgirvislsmf
    gsvpdvadvvisdpvmagtlavmhisekakfdldrvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y7pC (C:)
    ghmlrglriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdf
    ekilervktfdyiieieeeesfervfgkrviilgggalvsqvaigaiseadrhnlrgeri
    svdtmpvvgeeeiaeavkavsrlhraevlvlaggimggkiteevkklrksgirvislsmf
    gsvpdvadvvisdpvmagtlavmhisekakfdldrvkgrrigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7pC (C:)
    lriiaenkigvlrdlttiiaeeitfaqtflikhgehegkaliyfeilervktfdyiieie
    eeesfervfgkrviilgggalvsqvaigaiseadrhnlrgerisvdtmpvvgeeeiaeav
    kavsrlhraevlvlaggimggkiteevkklrksgirvislsmfgsvpdvadvvisdpvma
    gtlavmhisekakfdldrvkgrrigk