PDB entry 1y7o

View 1y7o on RCSB PDB site
Description: The structure of Streptococcus pneumoniae A153P ClpP
Class: hydrolase
Keywords: protease
Deposited on 2004-12-09, released 2005-02-08
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.192
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Streptococcus pneumoniae
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63788
      • modified residue (48)
      • modified residue (57)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (116)
      • modified residue (131)
      • modified residue (138)
      • modified residue (143)
      • engineered (159)
      • modified residue (181)
      • modified residue (194)
      • modified residue (209)
    Domains in SCOP 1.73: d1y7oa1
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Streptococcus pneumoniae
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63788 (20-End)
      • modified residue (48)
      • modified residue (57)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (116)
      • modified residue (131)
      • modified residue (138)
      • modified residue (143)
      • engineered (159)
      • modified residue (181)
      • modified residue (194)
      • modified residue (209)
    Domains in SCOP 1.73: d1y7ob1
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Streptococcus pneumoniae
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63788 (20-End)
      • modified residue (48)
      • modified residue (57)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (116)
      • modified residue (131)
      • modified residue (138)
      • modified residue (143)
      • engineered (159)
      • modified residue (181)
      • modified residue (194)
      • modified residue (209)
    Domains in SCOP 1.73: d1y7oc1
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Streptococcus pneumoniae
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63788 (20-End)
      • modified residue (48)
      • modified residue (57)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (116)
      • modified residue (131)
      • modified residue (138)
      • modified residue (143)
      • engineered (159)
      • modified residue (181)
      • modified residue (194)
      • modified residue (209)
    Domains in SCOP 1.73: d1y7od1
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Streptococcus pneumoniae
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63788 (20-End)
      • modified residue (48)
      • modified residue (57)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (116)
      • modified residue (131)
      • modified residue (138)
      • modified residue (143)
      • engineered (159)
      • modified residue (181)
      • modified residue (194)
      • modified residue (209)
    Domains in SCOP 1.73: d1y7oe1
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Streptococcus pneumoniae
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63788 (20-End)
      • modified residue (48)
      • modified residue (57)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (116)
      • modified residue (131)
      • modified residue (138)
      • modified residue (143)
      • engineered (159)
      • modified residue (181)
      • modified residue (194)
      • modified residue (209)
    Domains in SCOP 1.73: d1y7of1
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Streptococcus pneumoniae
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63788
      • modified residue (48)
      • modified residue (57)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (116)
      • modified residue (131)
      • modified residue (138)
      • modified residue (143)
      • engineered (159)
      • modified residue (181)
      • modified residue (194)
      • modified residue (209)
    Domains in SCOP 1.73: d1y7og1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7oA (A:)
    mgsshhhhhhssglvprgshmipvvieqtsrgersydiysrllkdriimltgpvednman
    sviaqllfldaqdstkdiylyvntpggsvsaglaivdtmnfikadvqtivmgmaasmgtv
    iassgakgkrfmlpnaeymihqpmggtgggtqqtdmaiapehllktrntlekilaensgq
    smekvhadaerdnwmsaqetleygfideimannslngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7oA (A:)
    ipvviesydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvntpggs
    vsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpmapeh
    llktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimann
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y7oB (B:)
    mgsshhhhhhssglvprgshmipvvieqtsrgersydiysrllkdriimltgpvednman
    sviaqllfldaqdstkdiylyvntpggsvsaglaivdtmnfikadvqtivmgmaasmgtv
    iassgakgkrfmlpnaeymihqpmggtgggtqqtdmaiapehllktrntlekilaensgq
    smekvhadaerdnwmsaqetleygfideimannslngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7oB (B:)
    mipvvieqtersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvn
    tpggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqp
    miapehllktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimanns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y7oC (C:)
    mgsshhhhhhssglvprgshmipvvieqtsrgersydiysrllkdriimltgpvednman
    sviaqllfldaqdstkdiylyvntpggsvsaglaivdtmnfikadvqtivmgmaasmgtv
    iassgakgkrfmlpnaeymihqpmggtgggtqqtdmaiapehllktrntlekilaensgq
    smekvhadaerdnwmsaqetleygfideimannslngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7oC (C:)
    mipvvieqrsydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvntp
    ggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpma
    pehllktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimannsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y7oD (D:)
    mgsshhhhhhssglvprgshmipvvieqtsrgersydiysrllkdriimltgpvednman
    sviaqllfldaqdstkdiylyvntpggsvsaglaivdtmnfikadvqtivmgmaasmgtv
    iassgakgkrfmlpnaeymihqpmggtgggtqqtdmaiapehllktrntlekilaensgq
    smekvhadaerdnwmsaqetleygfideimannslngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7oD (D:)
    mipvvieqtsersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyv
    ntpggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihq
    pmapehllktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimanns
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1y7oE (E:)
    mgsshhhhhhssglvprgshmipvvieqtsrgersydiysrllkdriimltgpvednman
    sviaqllfldaqdstkdiylyvntpggsvsaglaivdtmnfikadvqtivmgmaasmgtv
    iassgakgkrfmlpnaeymihqpmggtgggtqqtdmaiapehllktrntlekilaensgq
    smekvhadaerdnwmsaqetleygfideimannslngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7oE (E:)
    mipvviersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvntpg
    gsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpmap
    ehllktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimanns
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1y7oF (F:)
    mgsshhhhhhssglvprgshmipvvieqtsrgersydiysrllkdriimltgpvednman
    sviaqllfldaqdstkdiylyvntpggsvsaglaivdtmnfikadvqtivmgmaasmgtv
    iassgakgkrfmlpnaeymihqpmggtgggtqqtdmaiapehllktrntlekilaensgq
    smekvhadaerdnwmsaqetleygfideimannslngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7oF (F:)
    mipvvisydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvntpggs
    vsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpmapeh
    llktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimannsl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1y7oG (G:)
    mgsshhhhhhssglvprgshmipvvieqtsrgersydiysrllkdriimltgpvednman
    sviaqllfldaqdstkdiylyvntpggsvsaglaivdtmnfikadvqtivmgmaasmgtv
    iassgakgkrfmlpnaeymihqpmggtgggtqqtdmaiapehllktrntlekilaensgq
    smekvhadaerdnwmsaqetleygfideimannslngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7oG (G:)
    ipvvieqtersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvnt
    pggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpm
    iapehllktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimanns