PDB entry 1y7n

View 1y7n on RCSB PDB site
Description: Solution structure of the second PDZ domain of the human neuronal adaptor X11alpha
Class: protein transport
Keywords: copper chaperone for superoxide dismutase, neuronal adaptor
Deposited on 2004-12-09, released 2005-11-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 precursor protein-binding family A member 1
    Species: HOMO SAPIENS
    Gene: APBA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02410 (11-89)
      • his tag (6-10)
    Domains in SCOP 1.73: d1y7na1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1y7nA (A:)
hhhhhletmgnvttvlirrpdlryqlgfsvqngiicslmrggiaerggvrvghriieing
qsvvatphekivhilsnavgeihmktmpaa

    Sequence, based on observed residues (ATOM records): (download) 
    >1y7nA (A:)
etmgnvttvlirrpdlryqlgfsvqngiicslmrggiaerggvrvghriieingqsvvat
phekivhilsnavgeihmktmpaa