PDB entry 1y7n
View 1y7n on RCSB PDB site
Description: Solution structure of the second PDZ domain of the human neuronal adaptor X11alpha
Class: protein transport
Keywords: copper chaperone for superoxide dismutase, neuronal adaptor, PROTEIN TRANSPORT
Deposited on
2004-12-09, released
2005-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Amyloid beta A4 precursor protein-binding family A member 1
Species: Homo sapiens [TaxId:9606]
Gene: APBA1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1y7na1, d1y7na2
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1y7nA (A:)
hhhhhletmgnvttvlirrpdlryqlgfsvqngiicslmrggiaerggvrvghriieing
qsvvatphekivhilsnavgeihmktmpaa
Sequence, based on observed residues (ATOM records): (download)
>1y7nA (A:)
etmgnvttvlirrpdlryqlgfsvqngiicslmrggiaerggvrvghriieingqsvvat
phekivhilsnavgeihmktmpaa