PDB entry 1y7m

View 1y7m on RCSB PDB site
Description: Crystal Structure of the B. subtilis YkuD protein at 2 A resolution
Class: structural genomics, unknown function
Keywords: surface mutagenesis, cysteine proteases, cell wall catabolism, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-12-09, released 2005-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.214
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BSU14040
    Species: Bacillus subtilis [TaxId:224308]
    Gene: ykud
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34816 (0-163)
      • modified residue (0)
      • modified residue (75)
      • engineered (116-117)
      • modified residue (141)
    Domains in SCOPe 2.08: d1y7ma1, d1y7ma2
  • Chain 'B':
    Compound: hypothetical protein BSU14040
    Species: Bacillus subtilis [TaxId:224308]
    Gene: ykud
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34816 (0-163)
      • modified residue (0)
      • modified residue (75)
      • engineered (116-117)
      • modified residue (141)
    Domains in SCOPe 2.08: d1y7mb1, d1y7mb2
  • Heterogens: CD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7mA (A:)
    mltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyhiav
    sigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslsaahy
    gihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7mB (B:)
    mltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyhiav
    sigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslsaahy
    gihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr