PDB entry 1y7l

View 1y7l on RCSB PDB site
Description: O-Acetylserine Sulfhydrylase Complex
Class: transferase
Keywords: x-ray crystallography; Sulfhydrylase, TRANSFERASE
Deposited on 2004-12-09, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.197
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-acetylserine sulfhydrylase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: cysK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45040
      • modified residue (41)
    Domains in SCOPe 2.07: d1y7la1
  • Chain 'P':
    Compound: decamer fragment of Serine acetyltransferase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7lA (A:)
    maiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtlt
    kgkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgm
    kgaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtgg
    sitgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldl
    siidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilps
    aserylstalfegieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7lA (A:)
    aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
    gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgmk
    gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
    itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
    iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
    serylstalf
    

  • Chain 'P':
    No sequence available.