PDB entry 1y7k

View 1y7k on RCSB PDB site
Description: NMR structure family of Human Agouti Signalling Protein (80-132: Q115Y, S124Y)
Deposited on 2004-12-08, released 2005-02-15
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Agouti Signaling Protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42127 (Start-52)
      • engineered (35)
      • engineered (44)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y7kA (A:)
    kkvvrprtplsapcvatrnsckppapaccdpcascycrffrsacycrvlslnc
    

    Sequence, based on observed residues (ATOM records):
    >1y7kA (A:)
    cvatrnsckppapaccdpcascycrffrsacycrvlslnc