PDB entry 1y7i

View 1y7i on RCSB PDB site
Description: Structural and biochemical studies identify tobacco SABP2 as a methylsalicylate esterase and further implicate it in plant innate immunity, Northeast Structural Genomics Target AR2241
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2004-12-08, released 2004-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0 (Start-259)
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
    Domains in SCOPe 2.06: d1y7ia_
  • Chain 'B':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0 (Start-259)
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
      • expression tag (260-263)
    Domains in SCOPe 2.06: d1y7ib1, d1y7ib2
  • Heterogens: SAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7iA (A:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7iA (A:)
    egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
    melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
    nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
    medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
    cepqklcaslleiahkyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y7iB (B:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7iB (B:)
    egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
    melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
    nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
    medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
    cepqklcaslleiahkynlehh