PDB entry 1y7i

View 1y7i on RCSB PDB site
Description: Structural and biochemical studies identify tobacco SABP2 as a methylsalicylate esterase and further implicate it in plant innate immunity, Northeast Structural Genomics Target AR2241
Deposited on 2004-12-08, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1y7ia_
  • Chain 'B':
    Domains in SCOP 1.71: d1y7ib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7iA (A:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7iA (A:)
    egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
    melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
    nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
    medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
    cepqklcaslleiahkyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y7iB (B:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7iB (B:)
    egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
    melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
    nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
    medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
    cepqklcaslleiahkynlehh