PDB entry 1y7e

View 1y7e on RCSB PDB site
Description: The Crystal Structure of Aminopeptidase I from Borrelia burgdorferi B31
Class: hydrolase
Keywords: aminopeptidase I, Borrelia burgdorferi B31, yscI, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2004-12-08, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.202
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable M18-family aminopeptidase 1
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: apeA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45055 (Start-457)
      • modified residue (60)
      • modified residue (88)
      • modified residue (307)
      • modified residue (362)
      • modified residue (425)
      • modified residue (432)
      • modified residue (436)
    Domains in SCOPe 2.07: d1y7ea1, d1y7ea2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7eA (A:)
    mkkqnpwiylneeeknqilnfsesykkfiskfkterevtayaldkakklgfinaeekknl
    mpgdkifytcreksvafaiigknpiedgmnfivshtdsprldakpspiseeneltfiktn
    yyggikkyqwlstplsirgvvflkngekveinigdnendpvfvipdilphldrkiqrnkk
    sdeivegenlkiligslpietkeknkvklatlqlikekykieeedfvsseieivpagtak
    dvgfdkaligaygqddkicvftslesifdleetpnktaicflvdkeeigstgstgldsry
    leyfvsdmifkikkseynnlhvqkalwnsksisadvcaainplfssvhdeqnapqlgygi
    pimkytghggksmasdadaelvsyirqllnknniawqvatlgkveeggggtvakflagyg
    irtidmgpavismhspmeitskfdlynaylaykafyre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7eA (A:)
    qnpwiylneeeknqilnfsesykkfiskfkterevtayaldkakklgfinaeekknlmpg
    dkifytcreksvafaiigknpiedgmnfivshtdsprldakpspiseeneltfiktnyyg
    gikkyqwlstplsirgvvflkngekveinigdnendpvfvipdilnlkiligslpietke
    knkvklatlqlikekykieeedfvsseieivpagtakdvgfdkaligaygqddkicvfts
    lesifdleetpnktaicflvdkeeidsryleyfvsdmifkikkseynnlhvqkalwnsks
    isadvcaainpeqnapqlgygipimkytdaelvsyirqllnknniawqvatlgkggtvak
    flagygirtidmgpavismhspmeitskfdlynaylaykafyre