PDB entry 1y7b

View 1y7b on RCSB PDB site
Description: beta-d-xylosidase, a family 43 glycoside hydrolase
Class: hydrolase
Keywords: beta-propeller, beta-sandwich, structural genomics, protein structure initative, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, Protein Structure Initiative, HYDROLASE
Deposited on 2004-12-08, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-xylosidase, family 43 glycosyl hydrolase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: xynD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97DM1 (Start-534)
      • cloning artifact (1-2)
      • cloning artifact (534)
    Domains in SCOPe 2.07: d1y7ba1, d1y7ba2, d1y7ba3, d1y7ba4
  • Chain 'B':
    Compound: Beta-xylosidase, family 43 glycosyl hydrolase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: xynD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97DM1 (Start-534)
      • cloning artifact (1-2)
      • cloning artifact (534)
    Domains in SCOPe 2.07: d1y7bb1, d1y7bb2, d1y7bb3, d1y7bb4
  • Chain 'C':
    Compound: Beta-xylosidase, family 43 glycosyl hydrolase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: xynD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97DM1 (Start-534)
      • cloning artifact (1-2)
      • cloning artifact (534)
    Domains in SCOPe 2.07: d1y7bc1, d1y7bc2, d1y7bc3, d1y7bc4
  • Chain 'D':
    Compound: Beta-xylosidase, family 43 glycosyl hydrolase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: xynD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97DM1 (Start-534)
      • cloning artifact (1-2)
      • cloning artifact (534)
    Domains in SCOPe 2.07: d1y7bd1, d1y7bd2, d1y7bd3, d1y7bd4
  • Heterogens: CA, SO4, EPE, PGE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7bA (A:)
    msliknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrts
    lldmkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpi
    tlngsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykg
    tdikytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdp
    rnslqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdn
    wprvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslriplteniaslkak
    kgnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyyntenwst
    iqvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdg
    inwskvpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykeeghhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7bA (A:)
    sliknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtsl
    ldmkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpit
    lngsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykgt
    dikytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdpr
    nslqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdnw
    prvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslriplteniaslkakk
    gnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyyntenwsti
    qvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdgi
    nwskvpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y7bB (B:)
    msliknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrts
    lldmkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpi
    tlngsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykg
    tdikytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdp
    rnslqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdn
    wprvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslriplteniaslkak
    kgnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyyntenwst
    iqvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdg
    inwskvpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykeeghhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7bB (B:)
    sliknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtsl
    ldmkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpit
    lngsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykgt
    dikytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdpr
    nslqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdnw
    prvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslriplteniaslkakk
    gnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyyntenwsti
    qvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdgi
    nwskvpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y7bC (C:)
    msliknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrts
    lldmkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpi
    tlngsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykg
    tdikytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdp
    rnslqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdn
    wprvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslriplteniaslkak
    kgnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyyntenwst
    iqvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdg
    inwskvpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykeeghhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7bC (C:)
    sliknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtsl
    ldmkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpit
    lngsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykgt
    dikytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdpr
    nslqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdnw
    prvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslriplteniaslkakk
    gnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyyntenwsti
    qvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdgi
    nwskvpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y7bD (D:)
    msliknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrts
    lldmkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpi
    tlngsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykg
    tdikytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdp
    rnslqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdn
    wprvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslriplteniaslkak
    kgnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyyntenwst
    iqvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdg
    inwskvpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykeeghhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7bD (D:)
    sliknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtsl
    ldmkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpit
    lngsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykgt
    dikytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdpr
    nslqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdnw
    prvvggkqgsvnveapkipevkwektydekdnfdsdklninfqslriplteniaslkakk
    gnlrlygkesltstftqafiarrwqsfkfdastsvsfspdtfqqaagltcyyntenwsti
    qvtwnedkgrvidivccdnfhfdmplksnvipipkdveyihlkvevrvetyqysysfdgi
    nwskvpaifesrklsddyvqgggfftgafvginciditgnnkpadfdyfcykee