PDB entry 1y7a

View 1y7a on RCSB PDB site
Description: Structure of D153H/K328W E. coli alkaline phosphatase in presence of cobalt at 1.77 A resolution
Class: hydrolase
Keywords: metal specificity, X-ray crystallography, high-spin/low-spin configurations, hydrolase
Deposited on 2004-12-08, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.205
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-448)
      • engineered (152)
      • engineered (327)
    Domains in SCOPe 2.07: d1y7aa_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-448)
      • engineered (152)
      • engineered (327)
    Domains in SCOPe 2.07: d1y7ab_
  • Heterogens: CO, PO4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7aA (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidwqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7aB (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidwqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk