PDB entry 1y79

View 1y79 on RCSB PDB site
Description: Crystal Structure of the E.coli Dipeptidyl Carboxypeptidase Dcp in Complex with a Peptidic Inhibitor
Deposited on 2004-12-08, released 2005-05-24
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Peptidyl-Dipeptidase Dcp
    Species: Escherichia coli [TaxId:562]
    Gene: dcp
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, LYS, GLY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records:
    >1y791 (1:)
    ttmnpflvqstlpylaphfdqianhhyrpafdegmqqkraeiaaialnpqmpdfnntila
    leqsgelltrvtsvffamtaahtndelqrldeqfsaelaelandiylngelfarvdavwq
    rreslgldsesirlvevihqrfvlagaklaqadkaklkvlnteaatltsqfnqrllaank
    sgglvvndiaqlagmseqeialaaeaarekgldnkwlipllnttqqpalaemrdratrek
    lfiagwtraekndandtraiiqrlveiraqqatllgfphyaawkiadqmaktpeaalnfm
    reivpaarqrasdelasiqavidkqqggfsaqpwdwafyaeqvrrekfdldeaqlkpyfe
    lntvlnegvfwtanqlfgikfverfdipvyhpdvrvweifdhngvglalfygdffardsk
    sggawmgnfveqstlnkthpviynvcnyqkpaagepalllwddvitlfhefghtlhglfa
    rqryatlsgtntprdfvefpsqinehwathpqvfaryarhyqsgaampdelqqkmrnasl
    fnkgyemsellsaalldmrwhcleeneamqdvddfelralvaenmdlpaippryrssyfa
    hifgggyaagyyaylwtqmladdgyqwfveqggltrenglrfreailsrgnsedlerlyr
    qwrgkapkimpmlqhrglni