PDB entry 1y76
View 1y76 on RCSB PDB site
Description: Solution Structure of Patj/Pals1 L27 Domain Complex
Class: transport protein
Keywords: L27 domain, scaffold protein, protein assembly, cell polarity, TRANSPORT PROTEIN
Deposited on
2004-12-08, released
2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein associated to tight junctions
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1y76a1 - Chain 'B':
Compound: MAGUK p55 subfamily member 5
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1y76b1 - Chain 'C':
Compound: protein associated to tight junctions
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1y76c_ - Chain 'D':
Compound: MAGUK p55 subfamily member 5
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1y76d_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1y76A (A:)
npaaekmqvlqvldrlrgklqekgdttqneklsafyetlksplfnqiltlqqsikqlkgq
ls
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1y76B (B:)
avkileiedlfsslkhiqhtlvdsqsqedislllqlvqnkdfqnafkihnaitvhmnkas
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1y76C (C:)
npaaekmqvlqvldrlrgklqekgdttqneklsafyetlksplfnqiltlqqsikqlkgq
ls
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1y76D (D:)
avkileiedlfsslkhiqhtlvdsqsqedislllqlvqnkdfqnafkihnaitvhmnkas