PDB entry 1y76

View 1y76 on RCSB PDB site
Description: Solution Structure of Patj/Pals1 L27 Domain Complex
Class: transport protein
Keywords: L27 domain, scaffold protein, protein assembly, cell polarity
Deposited on 2004-12-08, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein associated to tight junctions
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y76a1
  • Chain 'B':
    Compound: MAGUK p55 subfamily member 5
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y76b1
  • Chain 'C':
    Compound: protein associated to tight junctions
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y76c1
  • Chain 'D':
    Compound: MAGUK p55 subfamily member 5
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y76d1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y76A (A:)
    npaaekmqvlqvldrlrgklqekgdttqneklsafyetlksplfnqiltlqqsikqlkgq
    ls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y76B (B:)
    avkileiedlfsslkhiqhtlvdsqsqedislllqlvqnkdfqnafkihnaitvhmnkas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y76C (C:)
    npaaekmqvlqvldrlrgklqekgdttqneklsafyetlksplfnqiltlqqsikqlkgq
    ls
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y76D (D:)
    avkileiedlfsslkhiqhtlvdsqsqedislllqlvqnkdfqnafkihnaitvhmnkas