PDB entry 1y76

View 1y76 on RCSB PDB site
Description: Solution Structure of Patj/Pals1 L27 Domain Complex
Class: transport protein
Keywords: L27 domain, scaffold protein, protein assembly, cell polarity, TRANSPORT PROTEIN
Deposited on 2004-12-08, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein associated to tight junctions
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y76a1
  • Chain 'B':
    Compound: MAGUK p55 subfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y76b1
  • Chain 'C':
    Compound: protein associated to tight junctions
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y76c_
  • Chain 'D':
    Compound: MAGUK p55 subfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y76d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y76A (A:)
npaaekmqvlqvldrlrgklqekgdttqneklsafyetlksplfnqiltlqqsikqlkgq
ls

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y76B (B:)
avkileiedlfsslkhiqhtlvdsqsqedislllqlvqnkdfqnafkihnaitvhmnkas

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y76C (C:)
npaaekmqvlqvldrlrgklqekgdttqneklsafyetlksplfnqiltlqqsikqlkgq
ls

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y76D (D:)
avkileiedlfsslkhiqhtlvdsqsqedislllqlvqnkdfqnafkihnaitvhmnkas