PDB entry 1y75

View 1y75 on RCSB PDB site
Description: A new form of catalytically inactive phospholipase A2 with an unusual disulphide bridge Cys 32- Cys 49 reveals recognition for N-acetylglucosmine
Class: hydrolase
Keywords: Enzyme, Activity, Molecular association, HYDROLASE
Deposited on 2004-12-08, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase A2 isoform 5
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y75a_
  • Chain 'B':
    Compound: phospholipase A2 isoform 6
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y75b_
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y75A (A:)
    ntyqfrnmiqctvpsrswwdfadygcycgcgsgtpvddldrccqvhcncyrqageisgcr
    pkfktytyecsggtltckgdnnacaasscdcdrlaaicfagapyndnnynidlkarcn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y75B (B:)
    nikqfnnmiqctvparswwdfadygcycgsgsgspvddldrccqvhdncynagggvtgca
    pksktytyecsqgtltcsgensacaatvcdcdrlaaicfagapyndnnynidlksrcq