PDB entry 1y74

View 1y74 on RCSB PDB site
Description: Solution Structure of mLin-2/mLin-7 L27 Domain Complex
Class: transport protein
Keywords: L27 domain, scaffold protein, protein assembly, cell polarity, TRANSPORT PROTEIN
Deposited on 2004-12-08, released 2005-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lin 7 homolog b
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O88951 (0-56)
  Domains in SCOPe 2.06: d1y74a1
• Chain 'B':
  Compound: Peripheral plasma membrane protein CASK
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O70589 (0-49)
  Domains in SCOPe 2.06: d1y74b_
• Chain 'C':
  Compound: lin 7 homolog b
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O88951 (0-56)
  Domains in SCOPe 2.06: d1y74c_
• Chain 'D':
  Compound: Peripheral plasma membrane protein CASK
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O70589 (0-49)
  Domains in SCOPe 2.06: d1y74d_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y74A (A:)
  lglerdvsravellerlqrsgelppqklqalqrvlqsrfcsairevyeqlydtldit
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y74B (B:)
  avqrakevleeiscypenndakelkriltqphfmallqthdvvahevysd
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y74C (C:)
  lglerdvsravellerlqrsgelppqklqalqrvlqsrfcsairevyeqlydtldit
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y74D (D:)
  avqrakevleeiscypenndakelkriltqphfmallqthdvvahevysd