PDB entry 1y74
View 1y74 on RCSB PDB site
Description: Solution Structure of mLin-2/mLin-7 L27 Domain Complex
Class: transport protein
Keywords: L27 domain, scaffold protein, protein assembly, cell polarity, TRANSPORT PROTEIN
Deposited on
2004-12-08, released
2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: lin 7 homolog b
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1y74a1 - Chain 'B':
Compound: Peripheral plasma membrane protein CASK
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1y74b_ - Chain 'C':
Compound: lin 7 homolog b
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1y74c_ - Chain 'D':
Compound: Peripheral plasma membrane protein CASK
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1y74d_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1y74A (A:)
lglerdvsravellerlqrsgelppqklqalqrvlqsrfcsairevyeqlydtldit
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1y74B (B:)
avqrakevleeiscypenndakelkriltqphfmallqthdvvahevysd
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1y74C (C:)
lglerdvsravellerlqrsgelppqklqalqrvlqsrfcsairevyeqlydtldit
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1y74D (D:)
avqrakevleeiscypenndakelkriltqphfmallqthdvvahevysd