PDB entry 1y6z

View 1y6z on RCSB PDB site
Description: Middle domain of Plasmodium falciparum putative heat shock protein PF14_0417
Class: structural genomics, unknown function
Keywords: heat shock, chaperone, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2004-12-07, released 2005-02-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein, putative
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1y6za_
  • Chain 'B':
    Compound: heat shock protein, putative
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1y6zb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y6zA (A:)
    ghqlpiwkqdeksltendyysfykntfkayddplayvhfnvegqisfnsilyipgslpwe
    lsknmfdeesrgirlyvkrvfindkfsesiprwltflrgivdsenlplnvgreilqkskm
    lsiinkrivlksismmkglketggdkwtkflntfgkylkigvvedkenqeeiaslvefys
    insgdkktdldsyienmkedqkciyyisgenkktaqnspsleklkalnydvlfslepide
    fclssltvnkykgyevldvnkad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6zA (A:)
    piwkqdeksltendyysfykntfkayddplayvhfnvegqisfnsilyipgslpwelskn
    mfrgirlyvkrvfindkfsesiprwltflrgivdsenskmlsiinkrivlksismmkglk
    etggdkwtkflntfgkylkigvvedkenqeeiaslvefysinsgdkktdldsyienmked
    qkciyyisgenkktaqnspsleklkalnydvlfslepidefclssltvnkykgyevldvn
    ka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y6zB (B:)
    ghqlpiwkqdeksltendyysfykntfkayddplayvhfnvegqisfnsilyipgslpwe
    lsknmfdeesrgirlyvkrvfindkfsesiprwltflrgivdsenlplnvgreilqkskm
    lsiinkrivlksismmkglketggdkwtkflntfgkylkigvvedkenqeeiaslvefys
    insgdkktdldsyienmkedqkciyyisgenkktaqnspsleklkalnydvlfslepide
    fclssltvnkykgyevldvnkad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6zB (B:)
    lpiwkqdeksltendyysfykntfkayddplayvhfnvegqisfnsilyipgslpwelsk
    nmfdeesrgirlyvkrvfindkfsesiprwltflrgivdsenkskmlsiinkrivlksis
    mmkglketggdkwtkflntfgkylkigvvedkenqeeiaslvefysinsgdkktdldsyi
    enmkedqkciyyisgenkktaqnspsleklkalnydvlfslepidefclssltvnkykgy
    evldvn