PDB entry 1y6x

View 1y6x on RCSB PDB site
Description: The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis
Class: hydrolase
Keywords: helical bundle, phosphoribosyl-ATP, histidine, hydrolase, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2004-12-07, released 2005-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.183
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphoribosyl-ATP pyrophosphatase
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: hisE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A5B1 (Start-92)
    • modified residue (78)
  Domains in SCOPe 2.08: d1y6xa1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1y6xA (A:)
  mqqslavktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehes
  ndalaeeisqllywtqvlmisrglslddvyrkl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1y6xA (A:)
  vktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalae
  eisqllywtqvlmisrglslddvyrkl