PDB entry 1y6x

View 1y6x on RCSB PDB site
Description: The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis
Class: hydrolase
Keywords: helical bundle, phosphoribosyl-ATP, histidine, hydrolase, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2004-12-07, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.183
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5B1 (Start-92)
      • modified residue (78)
    Domains in SCOPe 2.07: d1y6xa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y6xA (A:)
    mqqslavktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehes
    ndalaeeisqllywtqvlmisrglslddvyrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6xA (A:)
    vktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalae
    eisqllywtqvlmisrglslddvyrkl