PDB entry 1y6u

View 1y6u on RCSB PDB site
Description: The Structure of the Excisionase (Xis) Protein from Conjugative Transposon Tn916 Provides Insights into the Regulation of Heterobivalent Tyrosine Recombinases
Deposited on 2004-12-07, released 2005-03-15
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Excisionase from transposon Tn916
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: Xis
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y6uA (A:)
    aghmkqtdipiwerytltieeaskyfrigenklrrlaeenknanwlimngnriqikrkqf
    ekiidtldai
    

    Sequence, based on observed residues (ATOM records):
    >1y6uA (A:)
    ipiwerytltieeaskyfrigenklrrlaeenknanwlimngnriqikrkqfekiidtl