PDB entry 1y6q

View 1y6q on RCSB PDB site
Description: Cyrstal structure of MTA/AdoHcy nucleosidase complexed with MT-DADMe-ImmA
Class: hydrolase
Keywords: mixed alpha/beta dimer, HYDROLASE
Deposited on 2004-12-06, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MTA/SAH nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: mtnN, mtn, pfs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24247 (10-241)
      • cloning artifact (8-9)
    Domains in SCOPe 2.07: d1y6qa2, d1y6qa3
  • Chain 'B':
    Compound: MTA/SAH nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: mtnN, mtn, pfs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y6qb_
  • Heterogens: CL, TDI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y6qA (A:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6qA (A:)
    fsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalg
    atlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpag
    fkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeatai
    ahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y6qB (B:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6qB (B:)
    mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
    lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
    addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
    vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg