PDB entry 1y6p

View 1y6p on RCSB PDB site
Description: Crystal structure of disulfide engineered porcine pancratic phospholipase a2 to group-x isozyme
Class: hydrolase
Keywords: Hydrolase, Disulfide engineered PLA2, Porcine pancratic isozyme
Deposited on 2004-12-06, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.188
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00592 (0-123)
      • engineered (7)
      • engineered (19)
      • engineered (49)
      • see remark 999 (124-130)
    Domains in SCOPe 2.07: d1y6pa_
  • Chain 'B':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00592 (0-123)
      • engineered (7)
      • engineered (19)
      • engineered (49)
      • see remark 999 (124-130)
    Domains in SCOPe 2.07: d1y6pb_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y6pA (A:)
    alwqfrslikcaipgshplldfnnygcycglggsgtpvdeldrccethdccyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyckgesdkc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y6pB (B:)
    alwqfrslikcaipgshplldfnnygcycglggsgtpvdeldrccethdccyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyckgesdkc