PDB entry 1y6o

View 1y6o on RCSB PDB site
Description: Crystal structure of disulfide engineered porcine pancreatic phospholipase A2 to group-X isozyme in complex with inhibitor MJ33 and phosphate ions
Class: hydrolase
Keywords: Hydrolase. Disulfide engineered PLA2. Porcine pancratic isozyme., HYDROLASE
Deposited on 2004-12-06, released 2005-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00592 (0-123)
      • engineered (7)
      • engineered (19)
      • engineered (49)
      • see remark 999 (124-130)
    Domains in SCOPe 2.06: d1y6oa_
  • Chain 'B':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00592 (0-123)
      • engineered (7)
      • engineered (19)
      • engineered (49)
      • see remark 999 (124-130)
    Domains in SCOPe 2.06: d1y6ob_
  • Heterogens: CA, PO4, MJI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y6oA (A:)
alwqfrslikcaipgshplldfnnygcycglggsgtpvdeldrccethdccyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyckgesdkc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y6oB (B:)
alwqfrslikcaipgshplldfnnygcycglggsgtpvdeldrccethdccyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyckgesdkc