PDB entry 1y6l

View 1y6l on RCSB PDB site
Description: Human ubiquitin conjugating enzyme E2E2
Class: ligase
Keywords: Structural Genomics Consortium, UBIQUITIN, UBIQUITIN-CONJUGATING ENZYME, LIGASE, SGC
Deposited on 2004-12-06, released 2005-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.194
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2E2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E2, UBCH8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96LR5 (2-148)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d1y6la1, d1y6la2
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2E2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E2, UBCH8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96LR5 (2-148)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d1y6lb1, d1y6lb2
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2E2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E2, UBCH8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96LR5 (2-148)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d1y6lc1, d1y6lc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y6lA (A:)
    gstsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfsp
    dypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadp
    lvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6lA (A:)
    stsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspd
    ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl
    vgsiatqymtnraehdrmarqwtkryat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y6lB (B:)
    gstsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfsp
    dypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadp
    lvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6lB (B:)
    stsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspd
    ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl
    vgsiatqymtnraehdrmarqwtkryat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y6lC (C:)
    gstsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfsp
    dypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadp
    lvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6lC (C:)
    stsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspd
    ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl
    vgsiatqymtnraehdrmarqwtkryat