PDB entry 1y6k

View 1y6k on RCSB PDB site
Description: Crystal structure of human IL-10 complexed with the soluble IL-10R1 chain
Class: immune system
Keywords: helix bundle, receptor complex, immune system
Deposited on 2004-12-06, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-30, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: interleukin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: IL10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y6kl_
  • Chain 'R':
    Compound: interleukin-10 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL10RA, IL10R
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13651
      • engineered (28)
      • engineered (52)
      • engineered (88)
      • engineered (132)
      • engineered (155)
      • engineered (167)
    Domains in SCOPe 2.07: d1y6kr1, d1y6kr2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1y6kL (L:)
    spgqgtqsenscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgyl
    gcqalsemiqfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkska
    veqvknafnklqekgiykamsefdifinyieaymtmkirn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6kL (L:)
    cthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiqf
    yleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnkl
    qekgiykamsefdifinyieaymtm
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1y6kR (R:)
    hgtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsy
    dltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvdevtltvgsvnleihngfilg
    kiqlprpkmapaqdtyesifshfreyeiairkvpgqftfthkkvkheqfslltsgevgef
    cvqvkpsvasrsnkgmwskeecisltrqyftvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y6kR (R:)
    gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
    ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvdevtltvgsvnleihngfilgk
    iqlprpkmapaqdtyesifshfreyeiairkvpgqftfthkkvkheqfslltsgevgefc
    vqvkpsvasrsnkgmwskeecislt