PDB entry 1y6i

View 1y6i on RCSB PDB site
Description: Synechocystis GUN4
Class: ligand binding protein
Keywords: Helix-Bundle, Porphyrin Binding, LIGAND BINDING PROTEIN
Deposited on 2004-12-06, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mg-chelatase cofactor GUN4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: gun4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y6ia1, d1y6ia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y6iA (A:)
    msdnltelsqqlhdasekkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyq
    tlrnleqetittqlqrnyptgifplqsaqgidylplqealgsqdfetadeitrdklcela
    gpgasqrqwlyftevekfpaldlhtinalwwlhsngnfgfsvqrrlwlasgkeftklwpk
    igwksgnvwtrwpkgftwdlsapqghlpllnqlrgvrvaeslyrhpvwsqygw