PDB entry 1y6h

View 1y6h on RCSB PDB site
Description: Crystal structure of LIPDF
Class: hydrolase
Keywords: open and close conformation, PDF
Deposited on 2004-12-06, released 2004-12-21
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Leptospira interrogans
    Gene: def
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y6ha_
  • Chain 'B':
    Compound: Peptide deformylase
    Species: Leptospira interrogans
    Gene: def
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y6hb_
  • Heterogens: ZN, GLY, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y6hA (A:)
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y6hB (B:)
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld