PDB entry 1y6g

View 1y6g on RCSB PDB site
Description: alpha-glucosyltransferase in complex with udp and a 13_mer dna containing a hmu base at 2.8 a resolution
Deposited on 2004-12-06, released 2005-08-30
The last revision was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA alpha-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04519 (3-402)
      • cloning artifact (0-2)
  • Chain 'B':
    Compound: DNA alpha-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04519 (3-402)
      • cloning artifact (0-2)
  • Chain 'C':
    Compound: 5'-d(*gp*ap*tp*ap*cp*tp*(5hu)p*ap*gp*ap*tp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*tp*ap*tp*cp*tp*gp*ap*gp*tp*ap*t)-3'
  • Heterogens: NCO, UDP, CL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y6gA (A:)
    mgsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsi
    pvilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhs
    vlslrrnlgleetvrradvifshsdngdfnkvlmkewypetvslfddieeaptvynfqpp
    mdivkvrstywkdvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglers
    pafiaikekgipyeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlskln
    qkylqrsleythlelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestf
    erikelssdralydrerekayeflyqhqdssfcfkeqfdiitk
    

    Sequence, based on observed residues (ATOM records):
    >1y6gA (A:)
    mgsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsi
    pvilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhs
    vlslrrnlgleetvrradvifshsdngdfnkvlmkewypaptvynfqppmdivkvrstyw
    kdvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglerspafiaikekgi
    pyeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlsklnqkylqrsleyt
    hlelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestferikelssdra
    lydrerekayeflyqhqdssfcfkeqfdiitk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y6gB (B:)
    mgsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsi
    pvilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhs
    vlslrrnlgleetvrradvifshsdngdfnkvlmkewypetvslfddieeaptvynfqpp
    mdivkvrstywkdvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglers
    pafiaikekgipyeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlskln
    qkylqrsleythlelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestf
    erikelssdralydrerekayeflyqhqdssfcfkeqfdiitk
    

    Sequence, based on observed residues (ATOM records):
    >1y6gB (B:)
    mgsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsi
    pvilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhs
    vlslrrnlgleetvrradvifshsdngdfnkvlmkewypeaptvynfqppmdivkvrsty
    wkdvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglerspafiaikekg
    ipyeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlsklnqkylqrsley
    thlelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestferikelssdr
    alydrerekayeflyqhqdssfcfkeqfdiitk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.