PDB entry 1y6d

View 1y6d on RCSB PDB site
Description: Solution structure and dynamics of LuxU from Vibrio harveyi, a phosphotransferase protein involved in bacterial quorum sensing
Class: transferase
Keywords: phosphotransferase, four-helix bundle, quorum sensing, phosphorelay
Deposited on 2004-12-06, released 2004-12-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphorelay protein luxU
    Species: Vibrio harveyi [TaxId:669]
    Gene: LuxU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1y6da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1y6dA (A:)
hhhhhhmntdvlnqqkieelsaeigsdnvpvlldiflgemdsyigtltelqgseqllylk
eishalkssaasfgadrlceraiaidkkakanqlqeqgmetsemlallhitrdayrswtn

    Sequence, based on observed residues (ATOM records): (download) 
    >1y6dA (A:)
mntdvlnqqkieelsaeigsdnvpvlldiflgemdsyigtltelqgseqllylkeishal
kssaasfgadrlceraiaidkkakanqlqeqgmetsemlallhitrdayrswtn