PDB entry 1y6b

View 1y6b on RCSB PDB site
Description: crystal structure of vegfr2 in complex with a 2-anilino-5-aryl-oxazole inhibitor
Deposited on 2004-12-05, released 2005-06-07
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KDR, FLK1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AAX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y6bA (A:)
    mdpdelpldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtv
    avkmlkegathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnls
    tylrskrnefvpyktkgarfrqgkdyvgaipvdlkrrldsitssqssassgfveekslsd
    veeeeapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkic
    dfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgasp
    ypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllq
    anaqqd
    

    Sequence, based on observed residues (ATOM records):
    >1y6bA (A:)
    rlpydaskwefprdrlklgkplgrggqvieadafgidktatcrtvavkmlkathsehral
    mselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyfltl
    ehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfplkwmapetifdrvy
    tiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtmldc
    whgepsqrptfselvehlgnllqana